Gene detail [Fasta]
Species | Wasmannia auropunctata |
---|---|
GenBank | http://www.ncbi.nlm.nih.gov/protein/XP_011692766.1 |
sequence |
PEP: >XP_011692766.1 MIYSLTDEIIQQCEDEINNLNTTRNEEKRTHKTFFDIQMDACSKENFTRKEISDNVLTMLLSSSDTIIATMNYVLFILAN |
Swiss-Prot | Cytochrome P450 4c21 |
KEGG | K17961 CYP82G1; cytochrome P450, family 82, subfamily G, polypeptide 1 [EC:1.14.-.-] |
SUPERFAMILY | SSF48264 Cytochrome P450 superfamily |
Gene3D | G3DSA:1.10.630.10 |
Pfam | PF00067 p450; Cytochrome P450 |
PRINTS | PR00463 |
Coils | Coil |
ProSitePatterns | PS00086 CYTOCHROME_P450; Cytochrome P450 cysteine heme-iron ligand signature. |
You might be interested in these researchers

You might be interested in these references
