Gene detail [Fasta]
Species | Wasmannia auropunctata |
---|---|
GenBank | http://www.ncbi.nlm.nih.gov/protein/XP_011692305.1 |
sequence |
PEP: >XP_011692305.1 MAEKLNGAILMFFCEFGYTLIGNAEIYCDGRKWNGTIPSCRMANVPAPTKCDFENPDLCWWEQDPLHDFDWKRHNFETPS |
Swiss-Prot | MAM and LDL-receptor class A domain-containing protein 1 (Fragment) |
SUPERFAMILY | SSF49899 Concanavalin A-like lectins/glucanases superfamily |
Gene3D | G3DSA:2.10.70.10 |
Pfam | PF01033 Somatomedin_B; Somatomedin B domain |
SMART | SM00137 |
ProSiteProfiles | PS50958 SMB_2; Somatomedin B (SMB) domain profile. |
ProSitePatterns | PS00524 SMB_1; Somatomedin B domain (SMB) signature. |
You might be interested in these researchers

You might be interested in these references
