Gene detail [Fasta]
Species | Wasmannia auropunctata |
---|---|
GenBank | http://www.ncbi.nlm.nih.gov/protein/XP_011691816.1 |
sequence |
PEP: >XP_011691816.1 MADLEAVLADVSYLMAMEKSKCTPAARASKKIVLPDPSVRSVMHRYLEKNNEVNFDTIFNQMLGYLLFKDFCETVAEEPI |
Swiss-Prot | G protein-coupled receptor kinase 1 |
KEGG | K00910 ADRBK, GRK; beta-adrenergic-receptor kinase [EC:2.7.11.15] |
SUPERFAMILY | SSF56112 Protein kinase-like (PK-like) superfamily |
Gene3D | G3DSA:2.30.29.30 |
Pfam | PF00615 RGS; Regulator of G protein signaling domain |
SMART | SM00315 |
ProSiteProfiles | PS51285 AGC_KINASE_CTER; AGC-kinase C-terminal domain profile. |
PRINTS | PR00717 |
Coils | Coil |
ProSitePatterns | PS00107 PROTEIN_KINASE_ATP; Protein kinases ATP-binding region signature. |
You might be interested in these researchers

You might be interested in these references
