Gene detail [Fasta]
Species | Wasmannia auropunctata |
---|---|
GenBank | http://www.ncbi.nlm.nih.gov/protein/XP_011691768.1 |
sequence |
PEP: >XP_011691768.1 MPGLIAVSEFVEETREDYNSPTTSTFVSRMPQCRQTITSLEETLDFDRDGLTKLKKAIKAIHNSGNAHVDNEVYLGRALE |
Swiss-Prot | Arf-GAP with SH3 domain, ANK repeat and PH domain-containing protein 1 |
KEGG | K12488 ASAP; Arf-GAP with SH3 domain, ANK repeat and PH domain-containing protein |
SUPERFAMILY | SSF50044 SH3-domain superfamily |
Gene3D | G3DSA:1.25.40.20 |
Pfam | PF01412 ArfGap; Putative GTPase activating protein for Arf |
SMART | SM00233 |
ProSiteProfiles | PS50088 ANK_REPEAT; Ankyrin repeat profile. |
PRINTS | PR00452 |
Coils | Coil |