Gene detail [Fasta]
Species | Wasmannia auropunctata |
---|---|
GenBank | http://www.ncbi.nlm.nih.gov/protein/XP_011691202.1 |
sequence |
PEP: >XP_011691202.1 MSSRPAEKPEQVLIIEPQNELRFRGPFTGGPVTSYIKLINPTNKKVYFKIKTTAPKRYCVRPNSGALKPKDVTEIAVCLQ |
Swiss-Prot | Vesicle-associated membrane protein/synaptobrevin-binding protein |
KEGG | K06096 VAPA; vesicle-associated membrane protein-associated protein A |
SUPERFAMILY | SSF49354 PapD-like superfamily |
Gene3D | G3DSA:2.60.40.360 |
Pfam | PF00635 Motile_Sperm; MSP (Major sperm protein) domain |
ProSiteProfiles | PS50202 MSP; Major sperm protein (MSP) domain profile. |
Coils | Coil |
PIRSF | PIRSF019693 |
You might be interested in these researchers

You might be interested in these references
