Gene detail [Fasta]
Species | Wasmannia auropunctata |
---|---|
GenBank | http://www.ncbi.nlm.nih.gov/protein/XP_011689721.1 |
sequence |
PEP: >XP_011689721.1 MTAAYSAIDWFSSNIFSRTQSCRRANLIRQKLTSPKWNRFKGIRLRWKDKIRLNNVIWRCWHMQFILKQNTLVCQFASPL |
Swiss-Prot | Carbohydrate-responsive element-binding protein |
KEGG | K09113 MLX; MAX-like protein X |
SUPERFAMILY | SSF47459 HLH, helix-loop-helix DNA-binding domain superfamily |
Gene3D | G3DSA:4.10.280.10 |
Pfam | PF00010 HLH; Helix-loop-helix DNA-binding domain |
SMART | SM00353 |
ProSiteProfiles | PS50888 BHLH; Myc-type, basic helix-loop-helix (bHLH) domain profile. |
Coils | Coil |
You might be interested in these researchers

You might be interested in these references
