Gene detail [Fasta]
Species | Wasmannia auropunctata |
---|---|
GenBank | http://www.ncbi.nlm.nih.gov/protein/XP_011689461.1 |
sequence |
PEP: >XP_011689461.1 MAAHKAGGQSTRKKVQVSMVIRDEVEKQHRAGVNSLQYDPALHRLYSAGRDSIIRIWNCRNMKEPYIQSMEHHTDWVNDI |
Swiss-Prot | WD repeat-containing protein 48 |
KEGG | K15361 WDR48, UAF1; WD repeat-containing protein 48 |
SUPERFAMILY | SSF50978 WD40 repeat-like superfamily |
Gene3D | G3DSA:2.130.10.10 |
Pfam | PF00400 WD40; WD domain, G-beta repeat |
SMART | SM00320 |
ProSiteProfiles | PS50294 WD_REPEATS_REGION; Trp-Asp (WD) repeats circular profile. |
PRINTS | PR00320 |
ProSitePatterns | PS00678 WD_REPEATS_1; Trp-Asp (WD) repeats signature. |
You might be interested in these researchers

You might be interested in these references
