Gene detail [Fasta]
| Species | Wasmannia auropunctata |
|---|---|
| GenBank | http://www.ncbi.nlm.nih.gov/protein/XP_011689413.1 |
| sequence |
PEP: >XP_011689413.1 MKLLPPIQLSQLPPVSAAGGIAGMEPRLTSGISLPLCPDWALWRAQYGPSIGFPPTTHPPPSPLLDFKTHLPTSLVSDPR |
| Swiss-Prot | Ets DNA-binding protein pokkuri |
| KEGG | K03211 ETV6_7, yan; ETS translocation variant 6/7 |
| SUPERFAMILY | SSF47769 SAM/Pointed domain superfamily |
| Gene3D | G3DSA:1.10.150.50 |
| Pfam | PF02198 SAM_PNT; Sterile alpha motif (SAM)/Pointed domain |
| SMART | SM00251 |
| ProSiteProfiles | PS51433 PNT; Pointed (PNT) domain profile. |
| PRINTS | PR00454 |
| ProSitePatterns | PS00346 ETS_DOMAIN_2; Ets-domain signature 2. |
You might be interested in these researchers
You might be interested in these references
