Gene detail [Fasta]
Species | Wasmannia auropunctata |
---|---|
GenBank | http://www.ncbi.nlm.nih.gov/protein/XP_011689381.1 |
sequence |
PEP: >XP_011689381.1 MAADGDAVIPDQEKVRIVSDFILHSPPGEFNEVFNDVRVLLNNDNLLKEGASGAFAQYNKDQLTPVKIDGSDHPALITEH |
Swiss-Prot | F-actin-capping protein subunit alpha |
KEGG | K10364 |
SUPERFAMILY | SSF90096 Subunits of heterodimeric actin filament capping protein Capz superfamily |
Gene3D | G3DSA:3.40.50.1820 |
Pfam | PF01267 F-actin_cap_A; F-actin capping protein alpha subunit |
PRINTS | PR00191 |
ProSitePatterns | PS00748 F_ACTIN_CAPPING_A_1; F-actin capping protein alpha subunit signature 1. |
You might be interested in these researchers

You might be interested in these references
