Gene detail [Fasta]
Species | Wasmannia auropunctata |
---|---|
GenBank | http://www.ncbi.nlm.nih.gov/protein/XP_011689259.1 |
sequence |
PEP: >XP_011689259.1 MFLESNWTWLAERWGNMADLAERVDDLICSFDSTGETTMDTLSMLIFGWMLFGLVVLCVGKYVYNRFVLNELTAAATAGS |
Swiss-Prot | C2 domain-containing protein 2 |
SUPERFAMILY | SSF49562 C2 domain (Calcium/lipid-binding domain, CaLB) superfamily |
Gene3D | G3DSA:3.30.60.20 |
Pfam | PF00130 C1_1; Phorbol esters/diacylglycerol binding domain (C1 domain) |
SMART | SM00109 |
ProSiteProfiles | PS50004 C2; C2 domain profile. |
ProSitePatterns | PS00479 ZF_DAG_PE_1; Zinc finger phorbol-ester/DAG-type signature. |
You might be interested in these researchers

You might be interested in these references
