Gene detail [Fasta]
Species | Wasmannia auropunctata |
---|---|
GenBank | http://www.ncbi.nlm.nih.gov/protein/XP_011689084.1 |
sequence |
PEP: >XP_011689084.1 MLGHFGSNESILGYLTVKDSQDVDLDAILGELCALERRCDGDIAATPAPDSQRSGRPTSARINPGDSTDIKNEGGMRTDS |
Swiss-Prot | Ras-associated and pleckstrin homology domains-containing protein 1 |
KEGG | K17704 APBB1IP, RIAM; amyloid beta A4 precursor protein-binding family B member 1-interacting protein |
SUPERFAMILY | SSF50729 PH domain-like superfamily |
Gene3D | G3DSA:3.10.20.90 |
Pfam | PF00788 RA; Ras association (RalGDS/AF-6) domain |
SMART | SM00314 |
ProSiteProfiles | PS50003 PH_DOMAIN; PH domain profile. |
You might be interested in these researchers

You might be interested in these references
