Gene detail [Fasta]
Species | Wasmannia auropunctata |
---|---|
GenBank | http://www.ncbi.nlm.nih.gov/protein/XP_011688581.1 |
sequence |
PEP: >XP_011688581.1 MRGSTGRPKVDRSTSPPPRKPAPSPAVHPVQELKALFSEPAANRAPSNGEKESDFRFEAIQCLRQSSRMIIKRPKNLPER |
Swiss-Prot | Sodium- and chloride-dependent GABA transporter 1 |
KEGG | K05034 SLC6A1; solute carrier family 6 (neurotransmitter transporter, GABA) member 1 |
SUPERFAMILY | SSF161070 SNF-like superfamily |
Pfam | PF00209 SNF; Sodium:neurotransmitter symporter family |
ProSiteProfiles | PS50267 NA_NEUROTRAN_SYMP_3; Sodium:neurotransmitter symporter family profile. |
PRINTS | PR00176 |
ProSitePatterns | PS00610 NA_NEUROTRAN_SYMP_1; Sodium:neurotransmitter symporter family signature 1. |
You might be interested in these researchers

You might be interested in these references
