Gene detail [Fasta]
Species | Wasmannia auropunctata |
---|---|
GenBank | http://www.ncbi.nlm.nih.gov/protein/XP_011687837.1 |
sequence |
PEP: >XP_011687837.1 MADKAMMKQIAEQKLKAFSIGTMGKRPLSKKELEEQRKKEQEQAAAQAFEEFVATFQETPSKTTSKVWVKAGTYDAGKRQ |
Swiss-Prot | U2 snRNP-associated SURP motif-containing protein |
KEGG | K12842 SR140; U2-associated protein SR140 |
SUPERFAMILY | SSF54928 RNA-binding domain, RBD superfamily |
Gene3D | G3DSA:1.25.40.90 |
Pfam | PF00076 RRM_1; RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain) |
SMART | SM00582 |
ProSiteProfiles | PS50102 RRM; Eukaryotic RNA Recognition Motif (RRM) profile. |
Coils | Coil |
You might be interested in these researchers

You might be interested in these references
