Gene detail [Fasta]
| Species | Wasmannia auropunctata |
|---|---|
| GenBank | http://www.ncbi.nlm.nih.gov/protein/XP_011686000.1 |
| sequence |
PEP: >XP_011686000.1 MYLVGLTGGIATGKSTVAAIFREHGIPVIDADLIARKVVEPGKPAWHKIQREFGPDVFLDKHLDRAKLGDLIFNDTEKRK |
| Swiss-Prot | Dephospho-CoA kinase domain-containing protein |
| KEGG | K00859 coaE; dephospho-CoA kinase [EC:2.7.1.24] |
| SUPERFAMILY | SSF52540 P-loop containing nucleoside triphosphate hydrolases superfamily |
| Gene3D | G3DSA:3.40.50.300 |
| Pfam | PF01121 CoaE; Dephospho-CoA kinase |
| ProSiteProfiles | PS51219 DPCK; Dephospho-CoA kinase (DPCK) domain profile. |
| TIGRFAM | TIGR00152 |
| Hamap | MF_00376 |
You might be interested in these researchers
You might be interested in these references
