Gene detail [Fasta]
Species | Drosophila erecta |
---|---|
GenBank | http://www.ncbi.nlm.nih.gov/protein/XP_001981574.1 |
sequence |
PEP: >XP_001981574.1 MEVQKEDMASTIDQLEKKWSHDKSNLGEILKTTSQTLTTQVTASEERAARAEAESRIEREWRISLQEKELKLKEKISNLQ |
Swiss-Prot | RUN and FYVE domain-containing protein 2 |
KEGG | K12478 EEA1; early endosome antigen 1 |
SUPERFAMILY | SSF57903 FYVE/PHD zinc finger superfamily |
Gene3D | G3DSA:3.30.40.10 |
Pfam | PF01363 FYVE; FYVE zinc finger |
SMART | SM00064 |
ProSiteProfiles | PS50178 ZF_FYVE; Zinc finger FYVE/FYVE-related type profile. |
Coils | Coil |
You might be interested in these researchers

You might be interested in these references
