Gene detail [Fasta]
Species | Drosophila erecta |
---|---|
GenBank | http://www.ncbi.nlm.nih.gov/protein/XP_001980522.1 |
sequence |
PEP: >XP_001980522.1 MDSTSASVVYANSFYAPNYSDTQQPQPQLQSQHQMFHASYMVRSPLGSGLGFGLGPAPNPQASTSSGLSPRSMYGDLYRF |
Swiss-Prot | RNA-binding protein cabeza |
SUPERFAMILY | SSF54928 RNA-binding domain, RBD superfamily |
Gene3D | G3DSA:3.30.70.330 |
Pfam | PF00641 zf-RanBP; Zn-finger in Ran binding protein and others |
SMART | SM00547 |
ProSiteProfiles | PS50102 RRM; Eukaryotic RNA Recognition Motif (RRM) profile. |
ProSitePatterns | PS01358 ZF_RANBP2_1; Zinc finger RanBP2-type signature. |
You might be interested in these researchers

You might be interested in these references
