Gene detail [Fasta]
Species | Drosophila erecta |
---|---|
GenBank | http://www.ncbi.nlm.nih.gov/protein/XP_001979338.1 |
sequence |
PEP: >XP_001979338.1 MADLRSRHNGTVAVEKESQIQTGSHHNNNRGLDKEASANGKPEKSDPMIYIIFVSLLFDLLAFTIILPLLPSLLEHYRQN |
Swiss-Prot | Major facilitator superfamily domain-containing protein 10 |
SUPERFAMILY | SSF103473 MFS general substrate transporter superfamily |
Gene3D | G3DSA:1.20.1250.20 |
Pfam | PF07690 MFS_1; Major Facilitator Superfamily |
ProSiteProfiles | PS50850 MFS; Major facilitator superfamily (MFS) profile. |
ProSitePatterns | PS00216 SUGAR_TRANSPORT_1; Sugar transport proteins signature 1. |
You might be interested in these researchers

You might be interested in these references
