Gene detail [Fasta]
Species | Drosophila erecta |
---|---|
GenBank | http://www.ncbi.nlm.nih.gov/protein/XP_001978874.1 |
sequence |
PEP: >XP_001978874.1 MSLADMGTASRSAGGGGGGRHYDMATGGGAGGGLPGGRMTHSLSTPSGVDGTPSTPRHRGGKKLTVRIQMLDDSITMFQV |
Swiss-Prot | FERM, RhoGEF and pleckstrin domain-containing protein 2 |
KEGG | K06082 FARP2, FRG; FERM, RhoGEF and pleckstrin domain protein 2 |
SUPERFAMILY | SSF48065 DBL homology domain (DH-domain) superfamily |
Gene3D | G3DSA:1.20.80.10 |
Pfam | PF09380 FERM_C; FERM C-terminal PH-like domain |
SMART | SM00233 |
ProSiteProfiles | PS50057 FERM_3; FERM domain profile. |
PRINTS | PR00661 |
ProSitePatterns | PS00660 FERM_1; FERM domain signature 1. |
You might be interested in these researchers

You might be interested in these references
