Gene detail [Fasta]
Species | Drosophila erecta |
---|---|
GenBank | http://www.ncbi.nlm.nih.gov/protein/XP_001977687.1 |
sequence |
PEP: >XP_001977687.1 MWSPTHCSVTVQRARGLLTKGKNGTNNCFVTIALGKEKYQTSVKDKAETSVNWNEECELKIPDQGNRAELTLTCLHRNNL |
Swiss-Prot | Rab11 family-interacting protein 1 |
KEGG | K12484 RAB11FIP1_2_5; Rab11 family-interacting protein 1/2/5 |
SUPERFAMILY | SSF49562 C2 domain (Calcium/lipid-binding domain, CaLB) superfamily |
Gene3D | G3DSA:2.60.40.150 |
Pfam | PF09457 RBD-FIP; FIP domain |
SMART | SM00239 |
ProSiteProfiles | PS51511 FIP_RBD; FIP-RBD domain profile. |
Coils | Coil |
You might be interested in these researchers

You might be interested in these references
