Gene detail [Fasta]
Species | Drosophila erecta |
---|---|
GenBank | http://www.ncbi.nlm.nih.gov/protein/XP_001977087.1 |
sequence |
PEP: >XP_001977087.1 MLTRSILTVAVCGLLLSPLLPLTRASQEEDAAKQAEDKQIAVELDPETFDTAIAGGNVFVKFFAPWCGYCKRLQPLWEQL |
Swiss-Prot | Thioredoxin domain-containing protein 5 |
KEGG | K13984 TXNDC5, ERP46; thioredoxin domain-containing protein 5 |
SUPERFAMILY | SSF52833 Thioredoxin-like superfamily |
Gene3D | G3DSA:3.40.30.10 |
Pfam | PF00085 Thioredoxin; Thioredoxin |
ProSiteProfiles | PS51352 THIOREDOXIN_2; Thioredoxin domain profile. |
PRINTS | PR00421 |
ProSitePatterns | PS00194 THIOREDOXIN_1; Thioredoxin family active site. |
You might be interested in these researchers

You might be interested in these references
