Gene detail [Fasta]
Species | Drosophila erecta |
---|---|
GenBank | http://www.ncbi.nlm.nih.gov/protein/XP_001975311.1 |
sequence |
PEP: >XP_001975311.1 MFVARKITQTASLAVRGKHTLPKLPYDYAALEPIICREIMELHHQKHHQTYVNNLNAAEEQLEEAKSKSDTTKLIQLAPA |
Swiss-Prot | Superoxide dismutase [Mn], mitochondrial |
KEGG | K04564 SOD2; superoxide dismutase, Fe-Mn family [EC:1.15.1.1] |
SUPERFAMILY | SSF46609 Fe,Mn superoxide dismutase (SOD), N-terminal domain superfamily |
Gene3D | G3DSA:1.10.287.990 |
Pfam | PF02777 Sod_Fe_C; Iron/manganese superoxide dismutases, C-terminal domain |
PRINTS | PR01703 |
Coils | Coil |
ProSitePatterns | PS00088 SOD_MN; Manganese and iron superoxide dismutases signature. |
PIRSF | PIRSF000349 |
You might be interested in these researchers

You might be interested in these references
