Gene detail [Fasta]
Species | Drosophila erecta |
---|---|
GenBank | http://www.ncbi.nlm.nih.gov/protein/XP_001973399.1 |
sequence |
PEP: >XP_001973399.1 MLKQLKSQNHRVLIFSQMTKMLDILEDFLEGEQYKYERIDGGITGTLRQEAIDRFNAPGAQQFVFLLSTRAGGLGINLAT |
Swiss-Prot | Chromodomain-helicase-DNA-binding protein Mi-2 homolog |
KEGG | K11643 CHD4, MI2B; chromodomain-helicase-DNA-binding protein 4 [EC:3.6.4.12] |
SUPERFAMILY | SSF52540 P-loop containing nucleoside triphosphate hydrolases superfamily |
Gene3D | G3DSA:3.40.50.300 |
Pfam | PF06465 DUF1087; Domain of Unknown Function (DUF1087) |
SMART | SM00490 |
ProSiteProfiles | PS51194 HELICASE_CTER; Superfamilies 1 and 2 helicase C-terminal domain profile. |
Coils | Coil |
You might be interested in these researchers

You might be interested in these references
