Gene detail [Fasta]
Species | Drosophila erecta |
---|---|
GenBank | http://www.ncbi.nlm.nih.gov/protein/XP_001972649.1 |
sequence |
PEP: >XP_001972649.1 MEHVNSTNARQPQHHHFDQQLQHNDSQQQFCLRWHNHQTSLLSTLPILLDQSHLTDVTISAEGRQLRAHRVVLSACSSFF |
Swiss-Prot | Longitudinals lacking protein, isoforms H/M/V |
SUPERFAMILY | SSF54695 POZ domain superfamily |
Gene3D | G3DSA:3.30.710.10 |
Pfam | PF00096 zf-C2H2; Zinc finger, C2H2 type |
SMART | SM00225 |
ProSiteProfiles | PS50097 BTB; BTB domain profile. |
Coils | Coil |
ProSitePatterns | PS00028 ZINC_FINGER_C2H2_1; Zinc finger C2H2 type domain signature. |
You might be interested in these researchers

You might be interested in these references
