Gene detail [Fasta]
Species | Drosophila erecta |
---|---|
GenBank | http://www.ncbi.nlm.nih.gov/protein/XP_001971405.1 |
sequence |
PEP: >XP_001971405.1 MAASLFVFYTIMCVAFCTAWSSDIPELTQPFYNVLPFKYGTNCSSAPKFKNSKASVALRKTGEHVFLLVTYSCKKNYRLK |
Swiss-Prot | Signal peptide, CUB and EGF-like domain-containing protein 2 |
SUPERFAMILY | SSF57196 EGF/Laminin superfamily |
Gene3D | G3DSA:2.10.70.10 |
Pfam | PF00084 Sushi; Sushi repeat (SCR repeat) |
SMART | SM00179 |
ProSiteProfiles | PS50923 SUSHI; Sushi/CCP/SCR domain profile. |
ProSitePatterns | PS01187 EGF_CA; Calcium-binding EGF-like domain signature. |
You might be interested in these researchers

You might be interested in these references
