Gene detail [Fasta]
Species | Drosophila erecta |
---|---|
GenBank | http://www.ncbi.nlm.nih.gov/protein/XP_001970811.1 |
sequence |
PEP: >XP_001970811.1 MDNESENCSMEVVEPEDAESDMSSNSGSDEEDDNAEPKVPKEVYLPGTKLADDEELVCDESAYVMLHQASTGAPCLSFDV |
Swiss-Prot | Glutamate-rich WD repeat-containing protein 1 |
KEGG | K14848 |
SUPERFAMILY | SSF50978 WD40 repeat-like superfamily |
Gene3D | G3DSA:2.130.10.10 |
Pfam | PF12265 CAF1C_H4-bd; Histone-binding protein RBBP4 or subunit C of CAF1 complex |
SMART | SM00320 |
ProSiteProfiles | PS50082 WD_REPEATS_2; Trp-Asp (WD) repeats profile. |
PRINTS | PR00320 |
ProSitePatterns | PS00678 WD_REPEATS_1; Trp-Asp (WD) repeats signature. |
You might be interested in these researchers

You might be interested in these references
