Gene detail [Fasta]
Species | Drosophila erecta |
---|---|
GenBank | http://www.ncbi.nlm.nih.gov/protein/XP_001970499.1 |
sequence |
PEP: >XP_001970499.1 MMSSLCKYGPPRDSDSDSSYDGFYFSDEVKRPKPAPFVDPEQKLYDAVLDGDLKAMQQEMRSLVLPVDQAVKGGLNLLML |
Swiss-Prot | Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1 |
KEGG | K18410 |
SUPERFAMILY | SSF48403 Ankyrin repeat superfamily |
Gene3D | G3DSA:1.10.150.50 |
Pfam | PF12796 Ank_2; Ankyrin repeats (3 copies) |
SMART | SM00248 |
ProSiteProfiles | PS50297 ANK_REP_REGION; Ankyrin repeat region circular profile. |
You might be interested in these researchers

You might be interested in these references
