Gene detail [Fasta]
Species | Drosophila erecta |
---|---|
GenBank | http://www.ncbi.nlm.nih.gov/protein/XP_001970255.1 |
sequence |
PEP: >XP_001970255.1 MSRESRSKIAFKRKTSIGNKSAQLMDYERIRGELEVVVPSPPPPPVVTPSASLGKLKIKLSSAKISLRKNSQTPQNNLQT |
Swiss-Prot | Tripartite motif-containing protein 45 |
KEGG | K12021 |
SUPERFAMILY | SSF57845 B-box zinc-binding domain superfamily |
Gene3D | G3DSA:2.60.40.10 |
Pfam | PF00097 zf-C3HC4; Zinc finger, C3HC4 type (RING finger) |
SMART | SM00557 |
ProSiteProfiles | PS50119 ZF_BBOX; Zinc finger B-box type profile. |
ProSitePatterns | PS00518 ZF_RING_1; Zinc finger RING-type signature. |
You might be interested in these researchers

You might be interested in these references
