Gene detail [Fasta]
Species | Drosophila erecta |
---|---|
GenBank | http://www.ncbi.nlm.nih.gov/protein/XP_001969979.1 |
sequence |
PEP: >XP_001969979.1 MAHTRRPSDGLLARVNFPLYAVDMLTSRHILVAGGGGSSKTGVANGFEIYELYHNGSHFCAEEVLRHETGANVVMNFAVR |
Swiss-Prot | Prolactin regulatory element-binding protein |
KEGG | K14003 PREB, SEC12; prolactin regulatory element-binding protein |
SUPERFAMILY | SSF50978 WD40 repeat-like superfamily |
Gene3D | G3DSA:2.130.10.10 |
Pfam | PF00400 WD40; WD domain, G-beta repeat |
SMART | SM00320 |
ProSiteProfiles | PS50294 WD_REPEATS_REGION; Trp-Asp (WD) repeats circular profile. |
You might be interested in these researchers

You might be interested in these references
