Gene detail [Fasta]
Species | Drosophila erecta |
---|---|
GenBank | http://www.ncbi.nlm.nih.gov/protein/XP_001969484.1 |
sequence |
PEP: >XP_001969484.1 MAAEIKPAQRTNNDRFNTSKKPELLSKLEGSSDDVNAAILIPGENGVISVSDDKTVRVWLKRDSGQYWPSICQYMPSGCT |
Swiss-Prot | WD repeat and FYVE domain-containing protein 2 |
SUPERFAMILY | SSF50978 WD40 repeat-like superfamily |
Gene3D | G3DSA:3.30.40.10 |
Pfam | PF00400 WD40; WD domain, G-beta repeat |
SMART | SM00064 |
ProSiteProfiles | PS50294 WD_REPEATS_REGION; Trp-Asp (WD) repeats circular profile. |
PRINTS | PR00320 |
ProSitePatterns | PS00678 WD_REPEATS_1; Trp-Asp (WD) repeats signature. |
You might be interested in these researchers

You might be interested in these references
