Gene detail [Fasta]
Species | Drosophila erecta |
---|---|
GenBank | http://www.ncbi.nlm.nih.gov/protein/XP_001969446.1 |
sequence |
PEP: >XP_001969446.1 MPAFKVKVKWGRELYTDIDVNTDEEPILFKAQLFALTGVQPDRQKVMCKGGILKDDQWNLQIKDGAVVLLLGSKESVPEV |
Swiss-Prot | Ubiquitin carboxyl-terminal hydrolase 14 |
KEGG | K11843 |
SUPERFAMILY | SSF54001 Cysteine proteinases superfamily |
Gene3D | G3DSA:3.10.20.90 |
Pfam | PF00443 UCH; Ubiquitin carboxyl-terminal hydrolase |
SMART | SM00213 |
ProSiteProfiles | PS50235 USP_3; Ubiquitin specific protease (USP) domain profile. |
ProSitePatterns | PS00973 USP_2; Ubiquitin specific protease (USP) domain signature 2. |
You might be interested in these researchers

You might be interested in these references
