Gene detail [Fasta]
Species | Drosophila erecta |
---|---|
GenBank | http://www.ncbi.nlm.nih.gov/protein/XP_001968578.1 |
sequence |
PEP: >XP_001968578.1 MKLFWALLLISGVHRINAICRESIHLEHGSVEKLNGSILFLCDQGYSLQGSKVFTCDRGIPRGKKPFCAKSGCQEYKQIE |
Swiss-Prot | MAM and LDL-receptor class A domain-containing protein 2 (Fragment) |
SUPERFAMILY | SSF57535 Complement control module/SCR domain superfamily |
Gene3D | G3DSA:2.10.70.10 |
Pfam | PF00629 MAM; MAM domain, meprin/A5/mu |
SMART | SM00032 |
ProSiteProfiles | PS50958 SMB_2; Somatomedin B (SMB) domain profile. |
ProSitePatterns | PS00524 SMB_1; Somatomedin B domain (SMB) signature. |
You might be interested in these researchers

You might be interested in these references
