Gene detail [Fasta]
Species | Cerapachys biroi |
---|---|
GenBank | http://www.ncbi.nlm.nih.gov/protein/XP_011351748.1 |
sequence |
PEP: >XP_011351748.1 MCTHIIYSFIGVSNVTWEVLILDDELDVQQGGFDKFVALKKKYPHLQTEVAIGGWGEGGKKYSAMVSVKARRDSLIRSIV |
Swiss-Prot | Endochitinase |
SUPERFAMILY | SSF54556 Chitinase insertion domain superfamily |
Gene3D | G3DSA:3.20.20.80 |
Pfam | PF01607 CBM_14; Chitin binding Peritrophin-A domain |
SMART | SM00636 |
ProSiteProfiles | PS50940 CHIT_BIND_II; Chitin-binding type-2 domain profile. |
ProSitePatterns | PS01095 CHITINASE_18; Chitinases family 18 active site. |
PANTHER | PTHR11177:SF144 |
You might be interested in these researchers

You might be interested in these references
