Gene detail [Fasta]
| Species | Cerapachys biroi |
|---|---|
| GenBank | http://www.ncbi.nlm.nih.gov/protein/XP_011344971.1 |
| sequence |
PEP: >XP_011344971.1 MEKSFATHSHSVSIRSVSNSKYYLASAGADETVCLYDMRYRRGCGKLIHHNDTINCIAFTPENSHLFTCSNDGSIAAIRC |
| Swiss-Prot | p21-activated protein kinase-interacting protein 1-like |
| KEGG | K14830 |
| SUPERFAMILY | SSF50978 WD40 repeat-like superfamily |
| Gene3D | G3DSA:2.130.10.10 |
| Pfam | PF00400 WD40; WD domain, G-beta repeat |
| SMART | SM00320 |
| ProSiteProfiles | PS50082 WD_REPEATS_2; Trp-Asp (WD) repeats profile. |
| ProSitePatterns | PS00678 WD_REPEATS_1; Trp-Asp (WD) repeats signature. |
| PANTHER | PTHR22847 |
You might be interested in these researchers
You might be interested in these references
