Gene detail [Fasta]
Species | Cerapachys biroi |
---|---|
GenBank | http://www.ncbi.nlm.nih.gov/protein/XP_011344192.1 |
sequence |
PEP: >XP_011344192.1 MCALYSFATVTVALFLRIIGANISQLERDIGSDQFPPNEHYFGLVNFGNTCYSNSVLQALYFCRPFREKVLEYKARNKRT |
Swiss-Prot | Ubiquitin carboxyl-terminal hydrolase 46 |
KEGG | K11842 |
SUPERFAMILY | SSF54001 Cysteine proteinases superfamily |
Gene3D | G3DSA:2.20.210.10 |
Pfam | PF00443 UCH; Ubiquitin carboxyl-terminal hydrolase |
ProSiteProfiles | PS50235 USP_3; Ubiquitin specific protease (USP) domain profile. |
ProSitePatterns | PS00973 USP_2; Ubiquitin specific protease (USP) domain signature 2. |
PANTHER | PTHR24619:SF120 |
You might be interested in these researchers

You might be interested in these references
