Gene detail [Fasta]
| Species | Cerapachys biroi |
|---|---|
| GenBank | http://www.ncbi.nlm.nih.gov/protein/XP_011344190.1 |
| sequence |
PEP: >XP_011344190.1 MCALYSFATVTVALFLRIIGANISQLERDIGSDQFPPNEHYFGLVNFGNTCYSNSVLQALYFCRPFREKVLEYKARNKRT |
| Swiss-Prot | Ubiquitin carboxyl-terminal hydrolase 46 |
| KEGG | K11842 |
| SUPERFAMILY | SSF54001 Cysteine proteinases superfamily |
| Gene3D | G3DSA:2.20.210.10 |
| Pfam | PF00443 UCH; Ubiquitin carboxyl-terminal hydrolase |
| ProSiteProfiles | PS50235 USP_3; Ubiquitin specific protease (USP) domain profile. |
| ProSitePatterns | PS00973 USP_2; Ubiquitin specific protease (USP) domain signature 2. |
| PANTHER | PTHR24619 |
You might be interested in these researchers
You might be interested in these references
