Gene detail [Fasta]
| Species | Cerapachys biroi |
|---|---|
| GenBank | http://www.ncbi.nlm.nih.gov/protein/XP_011338054.1 |
| sequence |
PEP: >XP_011338054.1 MADQENKDFSEDIAEQNFAEQNGEAENGGADGDAMENNQESQEERSTGANQDSLNDRKLFVGGLSWETTDKELREHFSTY |
| Swiss-Prot | RNA-binding protein squid |
| KEGG | K03102 SQD; squid |
| SUPERFAMILY | SSF54928 RNA-binding domain, RBD superfamily |
| Gene3D | G3DSA:3.30.70.330 |
| Pfam | PF00076 RRM_1; RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain) |
| SMART | SM00360 |
| ProSiteProfiles | PS50102 RRM; Eukaryotic RNA Recognition Motif (RRM) profile. |
| PANTHER | PTHR24012 |
You might be interested in these researchers
You might be interested in these references
