Gene detail [Fasta]
Species | Cerapachys biroi |
---|---|
GenBank | http://www.ncbi.nlm.nih.gov/protein/XP_011336043.1 |
sequence |
PEP: >XP_011336043.1 MPRIMGPLLICCFLYLYLCCADNVTTSASECKLEDQLYLCPNQRCISLLKTCDGEDDCGDGQDENGSCPNSTAPCHSADC |
Swiss-Prot | Vitellogenin receptor |
SUPERFAMILY | SSF57196 EGF/Laminin superfamily |
Gene3D | G3DSA:2.10.25.10 |
Pfam | PF00058 Ldl_recept_b; Low-density lipoprotein receptor repeat class B |
SMART | SM00192 |
ProSiteProfiles | PS51120 LDLRB; LDL-receptor class B (LDLRB) repeat profile. |
ProSitePatterns | PS00010 ASX_HYDROXYL; Aspartic acid and asparagine hydroxylation site. |
PANTHER | PTHR10529:SF204 |
You might be interested in these researchers

You might be interested in these references
