Gene detail [Fasta]
| Species | Cerapachys biroi |
|---|---|
| GenBank | http://www.ncbi.nlm.nih.gov/protein/XP_011333569.1 |
| sequence |
PEP: >XP_011333569.1 MWRKDVTLVRSLVVATLISLIVDGVAAGSCSSAKLCCQGRDSGCVIQKESSNAIIESPRDKPCYCDHACLKLADCCDDFK |
| Swiss-Prot | Somatomedin-B and thrombospondin type-1 domain-containing protein |
| SUPERFAMILY | SSF82895 TSP-1 type 1 repeat superfamily |
| Gene3D | G3DSA:2.20.100.10 |
| Pfam | PF00090 TSP_1; Thrombospondin type 1 domain |
| SMART | SM00209 |
| ProSiteProfiles | PS50092 TSP1; Thrombospondin type-1 (TSP1) repeat profile. |
| ProSitePatterns | PS00524 SMB_1; Somatomedin B domain (SMB) signature. |
| PANTHER | PTHR20920:SF1 |
You might be interested in these researchers
You might be interested in these references
