Gene detail [Fasta]
Species | Bactrocera dorsalis |
---|---|
GenBank | http://www.ncbi.nlm.nih.gov/protein/XP_011211893.1 |
sequence |
PEP: >XP_011211893.1 MADCAPTPNASDKMASLLKEAENLKIKLEEERAKLNDINLWTVAERLEPIAFVNIKPRKVLKGHQAKVLCTDWSPDKRHI |
Swiss-Prot | Guanine nucleotide-binding protein subunit beta-5 |
KEGG | K04539 GNB5; guanine nucleotide-binding protein subunit beta-5 |
SUPERFAMILY | SSF50978 WD40 repeat-like superfamily |
Gene3D | G3DSA:2.130.10.10 |
Pfam | PF00400 WD40; WD domain, G-beta repeat |
SMART | SM00320 |
ProSiteProfiles | PS50294 WD_REPEATS_REGION; Trp-Asp (WD) repeats circular profile. |
PRINTS | PR00320 |
Coils | Coil |
ProSitePatterns | PS00678 WD_REPEATS_1; Trp-Asp (WD) repeats signature. |
PIRSF | PIRSF002394 |
PANTHER | PTHR19850:SF12 |
You might be interested in these researchers

You might be interested in these references
