Gene detail [Fasta]
Species | Bactrocera dorsalis |
---|---|
GenBank | http://www.ncbi.nlm.nih.gov/protein/XP_011210229.1 |
sequence |
PEP: >XP_011210229.1 MTSPPESPIEEVVFELEHTRVPKPINVTIEDLYRETKFSKQEIRIMYRGFKTECPEGVVHEECFKEIYAKFFPHGNSSLY |
Swiss-Prot | Kv channel-interacting protein 1 |
SUPERFAMILY | SSF47473 EF-hand superfamily |
Gene3D | G3DSA:1.10.238.10 |
Pfam | PF13499 EF-hand_7; EF-hand domain pair |
SMART | SM00054 |
ProSiteProfiles | PS50222 EF_HAND_2; EF-hand calcium-binding domain profile. |
PRINTS | PR00450 |
ProSitePatterns | PS00018 EF_HAND_1; EF-hand calcium-binding domain. |
PANTHER | PTHR23055:SF82 |
You might be interested in these researchers

You might be interested in these references
