Gene detail [Fasta]
| Species | Bactrocera dorsalis |
|---|---|
| GenBank | http://www.ncbi.nlm.nih.gov/protein/XP_011204183.1 |
| sequence |
PEP: >XP_011204183.1 MRLLNIKSVAFLLLSFVEYIYATPIVGGKVIYNPGNAPKYPYMISIQELYKPINSRGVEEFRHFCGGAMLNHWWFVTAAH |
| Swiss-Prot | Hyaluronan-binding protein 2 |
| SUPERFAMILY | SSF50494 Trypsin-like serine proteases superfamily |
| Gene3D | G3DSA:2.40.10.10 |
| Pfam | PF00089 Trypsin; Trypsin |
| SMART | SM00020 |
| ProSiteProfiles | PS50240 TRYPSIN_DOM; Serine proteases, trypsin domain profile. |
| PRINTS | PR00722 |
| ProSitePatterns | PS00134 TRYPSIN_HIS; Serine proteases, trypsin family, histidine active site. |
| PANTHER | PTHR24258 |
You might be interested in these researchers
You might be interested in these references
