Gene detail [Fasta]
Species | Bactrocera dorsalis |
---|---|
GenBank | http://www.ncbi.nlm.nih.gov/protein/XP_011199823.1 |
sequence |
PEP: >XP_011199823.1 MGGDAAIRRSATLTSTHNEMGTMAHLMEGQRDSEPYSTSRQGNGLAASRFACLRCCGKFISYLVRLRNTPEELEQRYKSR |
Swiss-Prot | Guanine nucleotide-binding protein subunit alpha homolog |
KEGG | K04346 GNA12; guanine nucleotide-binding protein subunit alpha-12 |
SUPERFAMILY | SSF52540 P-loop containing nucleoside triphosphate hydrolases superfamily |
Gene3D | G3DSA:3.40.50.300 |
Pfam | PF00503 G-alpha; G-protein alpha subunit |
SMART | SM00275 |
PRINTS | PR00440 |
PANTHER | PTHR10218:SF136 |
You might be interested in these researchers

You might be interested in these references
