Gene detail [Fasta]
| Species | Bactrocera dorsalis |
|---|---|
| GenBank | http://www.ncbi.nlm.nih.gov/protein/XP_011199027.1 |
| sequence |
PEP: >XP_011199027.1 MSVSSNASSASSSVTGVPISNGSGSRPSLGRPGSCDSSSAGSDSSELTHILNRRQVIMDSQEAGIEVPHQFKVVNVYTEF |
| Swiss-Prot | EF-hand domain-containing protein D2 homolog |
| SUPERFAMILY | SSF47473 EF-hand superfamily |
| Gene3D | G3DSA:1.10.238.10 |
| Pfam | PF13499 EF-hand_7; EF-hand domain pair |
| SMART | SM00054 |
| ProSiteProfiles | PS50222 EF_HAND_2; EF-hand calcium-binding domain profile. |
| Coils | Coil |
| ProSitePatterns | PS00018 EF_HAND_1; EF-hand calcium-binding domain. |
| PANTHER | PTHR13025 |
You might be interested in these researchers
You might be interested in these references
