Gene detail [Fasta]
Species | Apis dorsata |
---|---|
GenBank | http://www.ncbi.nlm.nih.gov/protein/XP_006625174.1 |
sequence |
PEP: >XP_006625174.1 MSGGVVPSKSTVYISNLPFSLTNNDIHQLLQNYGKIVKVTVMKDKITRRSRGVAFVLFLTPEDAITCAKNLNNTEIGGRT |
Swiss-Prot | Zinc finger CCHC-type and RNA-binding motif-containing protein 1 |
KEGG | K13154 |
SUPERFAMILY | SSF57756 Retrovirus zinc finger-like domains superfamily |
Gene3D | G3DSA:3.30.70.330 |
Pfam | PF00098 zf-CCHC; Zinc knuckle |
SMART | SM00360 |
ProSiteProfiles | PS50158 ZF_CCHC; Zinc finger CCHC-type profile. |
Coils | Coil |
PANTHER | PTHR23139:SF52 |
You might be interested in these researchers

You might be interested in these references
