Gene detail [Fasta]
Species | Apis dorsata |
---|---|
GenBank | http://www.ncbi.nlm.nih.gov/protein/XP_006622973.1 |
sequence |
PEP: >XP_006622973.1 MGCAVSTTGEKEAAERSKKIDKDLRADGERAASEVKLLLLGAGESGKSTIVKQMKIIHETGYSKEECEQYKPVVCSNTVQ |
Swiss-Prot | Guanine nucleotide-binding protein G(i) subunit alpha |
KEGG | K04630 GNAI; guanine nucleotide-binding protein G(i) subunit alpha |
SUPERFAMILY | SSF47895 Transducin (alpha subunit), insertion domain superfamily |
Gene3D | G3DSA:3.40.50.300 |
Pfam | PF00503 G-alpha; G-protein alpha subunit |
SMART | SM00275 |
PRINTS | PR00441 |
PANTHER | PTHR10218:SF178 |
You might be interested in these researchers

You might be interested in these references
