Gene detail [Fasta]
Species | Apis dorsata |
---|---|
GenBank | http://www.ncbi.nlm.nih.gov/protein/XP_006622263.1 |
sequence |
PEP: >XP_006622263.1 MASPRTRRILSELKPKDENNKCFECGTHNPQWVSVTYGIWICLECSGKHRGLGVHLSFVRSISMDKWKDLELEKMRVGGN |
Swiss-Prot | ADP-ribosylation factor GTPase-activating protein 1 |
KEGG | K12492 ARFGAP1; ADP-ribosylation factor GTPase-activating protein 1 |
SUPERFAMILY | SSF57863 ArfGap/RecO-like zinc finger superfamily |
Pfam | PF01412 ArfGap; Putative GTPase activating protein for Arf |
SMART | SM00105 |
ProSiteProfiles | PS50115 ARFGAP; ARF GTPase-activating proteins domain profile. |
PRINTS | PR00405 |
PANTHER | PTHR23180:SF35 |
You might be interested in these researchers

You might be interested in these references
