Gene detail [Fasta]
Species | Apis dorsata |
---|---|
GenBank | http://www.ncbi.nlm.nih.gov/protein/XP_006622156.1 |
sequence |
PEP: >XP_006622156.1 MKAAFLPDDFLQSTHNKYNRMNEENKQKSCNNSQRNNIGTHIMVSILSIGIGSVLFAYVAFASTIHNGTQTSIQQVIFVF |
Swiss-Prot | EH domain-containing protein 1 |
KEGG | K12483 EHD1; EH domain-containing protein 1 |
SUPERFAMILY | SSF53254 Phosphoglycerate mutase-like superfamily |
Gene3D | G3DSA:3.40.50.1240 |
Pfam | PF00350 Dynamin_N; Dynamin family |
SMART | SM00027 |
ProSiteProfiles | PS50031 EH; EH domain profile. |
ProSitePatterns | PS00616 HIS_ACID_PHOSPHAT_1; Histidine acid phosphatases phosphohistidine signature. |
PANTHER | PTHR11216:SF60 |
You might be interested in these researchers

You might be interested in these references
