Gene detail [Fasta]
Species | Apis dorsata |
---|---|
GenBank | http://www.ncbi.nlm.nih.gov/protein/XP_006621972.1 |
sequence |
PEP: >XP_006621972.1 MADLEAVLADVSYLMAMEKSKSTPAARASKKIILPDPSVRSVMHKYLEKKKEVNFDKIFNQMFGYLLFKDYCENVAEEPI |
Swiss-Prot | G protein-coupled receptor kinase 1 |
KEGG | K00910 ADRBK, GRK; beta-adrenergic-receptor kinase [EC:2.7.11.15] |
SUPERFAMILY | SSF50729 PH domain-like superfamily |
Gene3D | G3DSA:1.10.167.10 |
Pfam | PF00615 RGS; Regulator of G protein signaling domain |
SMART | SM00233 |
ProSiteProfiles | PS50011 PROTEIN_KINASE_DOM; Protein kinase domain profile. |
PRINTS | PR00717 |
Coils | Coil |
ProSitePatterns | PS00107 PROTEIN_KINASE_ATP; Protein kinases ATP-binding region signature. |
PANTHER | PTHR24355:SF18 |
You might be interested in these researchers

You might be interested in these references
