Gene detail [Fasta]
Species | Apis dorsata |
---|---|
GenBank | http://www.ncbi.nlm.nih.gov/protein/XP_006612607.1 |
sequence |
PEP: >XP_006612607.1 MESMVEENGSAVDPLSAGSQSGDAAPAIATSVQSVIQPNQQSVIQTATNIQPVAISKGNVILVSKPNSVIQTAQASLQTL |
Swiss-Prot | Cyclic AMP-responsive element-binding protein 1 |
KEGG | K05870 CREB1; cyclic AMP-responsive element-binding protein 1 |
SUPERFAMILY | SSF57959 Leucine zipper domain superfamily |
Gene3D | G3DSA:1.20.5.170 |
Pfam | PF02173 pKID; pKID domain |
SMART | SM00338 |
ProSiteProfiles | PS50217 BZIP; Basic-leucine zipper (bZIP) domain profile. |
PRINTS | PR00041 |
Coils | Coil |
ProSitePatterns | PS00036 BZIP_BASIC; Basic-leucine zipper (bZIP) domain signature. |
PANTHER | PTHR22952:SF101 |
You might be interested in these researchers

You might be interested in these references
