Gene detail [Fasta]
Species | Drosophila mojavensis |
---|---|
GenBank | http://www.ncbi.nlm.nih.gov/protein/XP_002008663.1 |
sequence |
PEP: >XP_002008663.1 MEIAPIYNTVVATAAAATATTSTSQHKQRQRRSAAAAAVLATTTATTAVGNTLINTDSRVHQNDNVNNLALIASLTLQKV |
Swiss-Prot | m7GpppN-mRNA hydrolase |
KEGG | K12613 DCP2; mRNA-decapping enzyme subunit 2 [EC:3.6.1.62] |
SUPERFAMILY | SSF55811 Nudix superfamily |
Gene3D | G3DSA:3.90.79.10 |
Pfam | PF05026 DCP2; Dcp2, box A domain |
ProSiteProfiles | PS51462 NUDIX; Nudix hydrolase domain profile. |
Coils | Coil |
ProSitePatterns | PS00893 NUDIX_BOX; Nudix box signature. |
You might be interested in these researchers

You might be interested in these references
